Protein Info for BWI76_RS03535 in Klebsiella michiganensis M5al

Updated annotation (from data): Tryptophanase (EC 4.1.99.1)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (4.1.99.1) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: tryptophanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 99% identical to TNAA_KLEAE: Tryptophanase (tnaA) from Klebsiella aerogenes

KEGG orthology group: K01667, tryptophanase [EC: 4.1.99.1] (inferred from 94% identity to cko:CKO_02849)

MetaCyc: 99% identical to tryptophanase subunit (Klebsiella aerogenes)
Tryptophanase. [EC: 4.1.99.1]

Predicted SEED Role

"Tryptophanase (EC 4.1.99.1)" in subsystem Aromatic amino acid degradation (EC 4.1.99.1)

MetaCyc Pathways

superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
D-serine degradation (3/3 steps found)
L-cysteine degradation II (3/3 steps found)
L-serine degradation (3/3 steps found)
L-tryptophan degradation II (via pyruvate) (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
purine nucleobases degradation II (anaerobic) (17/24 steps found)
glycine betaine degradation III (4/7 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXV7 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS03535 Tryptophanase (EC 4.1.99.1) (Klebsiella michiganensis M5al)
MKRIPEPFRIKMVENIRMTTFDDRVKALEEAGYNPFLLNSQDVYIDLLTDSGTGAMSDHQ
WAGLMMGDEAYAGSRNYQHLCEKVKEIIGYPYTIPTHQGRGAEQILFPSLIARRKSAHPV
FISNFHFDTTAAHVELNGAKAINVVTPKAFDTTSWYDWKGNFDIVLLKATIAEHGAENVA
AIITTVTCNSSGGQPVSLANMREVYQIARQNNIPVVIDSARFCENAWFIKQREEGYADKS
VKEIILEMYQYGDMLTMSAKKDPMVNIGGLCCFRDDEDLFNEVRIRCVPMEGFVTYGGLA
GRDMEALAIGLEEGTNEDYLAYRINQVEYLGERLREGGIPIQYPTGGHAVFVDAKLLLPH
IPPEQFPAHALNNELYLEAGIRSVEIGSLLLGRDPQTGKQKASPMELLRLTIPRRVYTND
HMDYIADALIAVKARAATIKGLTFTYEPPVLRHFVARLKPVK