Protein Info for BWI76_RS03530 in Klebsiella michiganensis M5al

Annotation: tryptophan permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 14 to 406 (393 residues), 517.4 bits, see alignment E=1.4e-159 TIGR00837: aromatic amino acid transport protein" amino acids 19 to 399 (381 residues), 524 bits, see alignment E=1.4e-161

Best Hits

Swiss-Prot: 79% identical to MTR_SHIFL: Tryptophan-specific transport protein (mtr) from Shigella flexneri

KEGG orthology group: K03835, tryptophan-specific transport protein (inferred from 91% identity to cko:CKO_02850)

MetaCyc: 79% identical to tryptophan:H+ symporter Mtr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-142; TRANS-RXN-76

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY26 at UniProt or InterPro

Protein Sequence (418 amino acids)

>BWI76_RS03530 tryptophan permease (Klebsiella michiganensis M5al)
MATLSVSKAVSTNTPSLIGGAMIIGGTIIGAGMFSLPVVMSGAWFFWSLLALIFTWFCML
HSGLMILEANLNYHIGASFDTITKDLLGNGWNIINGLTVAFVLYILTYAYISASGSVIQH
TFAQMDLAVPARLGGLAFALVVAFIVWLSTKAVSRMTTIVLGAKILTFFMTFGGLMWHVE
PAILFNRAEGNASYLPYVLMTLPFCLASFGYHGNVPSLMKYYGKDPLTIRRCLLLGTLMA
LVLYIIWLVGTMGNIPRPAFIAIAEKGGNIDVLVQTLSGLLNSSTLDLLLTVFSNFAVAS
SFLGVTLGLFDYLADLFKFDDSRLGRFKTALVTFLPPIAGGLLWPNGFIYAIGFAGLAAT
VWAAIVPALLARASRRRFGSPNYRVWGGNAMIILILCFGGANAIIHILSSFNLLPVYR