Protein Info for BWI76_RS03520 in Klebsiella michiganensis M5al

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 140 to 160 (21 residues), see Phobius details PF11563: Protoglobin" amino acids 31 to 160 (130 residues), 51.9 bits, see alignment E=1.3e-17 PF21118: DosC_2nd" amino acids 186 to 292 (107 residues), 61.6 bits, see alignment E=1.2e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 296 to 459 (164 residues), 170.9 bits, see alignment E=9.9e-55 PF00990: GGDEF" amino acids 302 to 455 (154 residues), 150 bits, see alignment E=7.9e-48

Best Hits

KEGG orthology group: None (inferred from 83% identity to eae:EAE_10030)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXU6 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BWI76_RS03520 diguanylate cyclase (Klebsiella michiganensis M5al)
MKDESQKYISIIFKEWLPLYDSLTPEVKAVLKNIAGQQAEALATRFYDFIFQDPDIARHL
TYDLVQERLSSSLAGWVKDILMCEKENLQALAERQYLIGSIHSRIGIPAEAVLRGARQLK
AGLIENIRDSHLDRETSVAAIYYAIMAINMAVEMMCHAYTLSHYRATKNEEAYRLYSLMD
NVPLEYGKQQASLSGWENSAIFNIVSDNKTDINGALLSDSEFGLWFRHKCVRYFNKNPQM
EEIADLISKVDALLSAWKSSSDGSEYKNTQALLQGIHIHCQQIGSQLGVLFSSLSQMQSG
KDSLTSLLNRRYLPVVLKHEVTLAMEYELPMTVAIIDIDHFKEINDSWGHMVGDRAIKHV
AELLSDNIRSSDYIFRYGGEEFLLVLVETGAAEAFTILERLRKKISQLAFSVGADNEISI
TASIGYAVHTGHPDYNLLLRDADSALYVAKRDGRNCVKLHESDSN