Protein Info for BWI76_RS03505 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 319 to 335 (17 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 26 to 364 (339 residues), 123.8 bits, see alignment E=1.3e-39 PF12679: ABC2_membrane_2" amino acids 28 to 368 (341 residues), 58.7 bits, see alignment E=9.2e-20 PF01061: ABC2_membrane" amino acids 167 to 336 (170 residues), 90.4 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 88% identical to YHHJ_ECOLI: Inner membrane transport permease YhhJ (yhhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_10015)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY05 at UniProt or InterPro

Protein Sequence (374 amino acids)

>BWI76_RS03505 membrane protein (Klebsiella michiganensis M5al)
MRGLRNIYNLGMKELRSLLGDKAMLTLIVFAFTVSVYSSATVMPGSLHLAPIAIADMDKS
QLSSRIINGFYRPWFLPPALITADEMDAGLDAGRYTFAINIPPDFQRDVLAGRQPELQVN
VDATRMSQAFTGNSYIQNIVTGEVNSFVTRYRDNGSLPVELAVRMRFNPNLEQERFGAVM
AIINNITMLAIVLTGSALIREREHGTVEHLLVMPVTPFEIMMAKIWSMGLVVLVVSGLSL
ILMVQGVLQVPIEGSIPLFMLGVALSLFATTSIGIFMGTVARSMPQLGLLMILVLLPLQM
LSGGSTPRESMPQAVQDIMLTMPTTHFVSLAQAILYRGADFSIVWPQFLTLLAIGGVFFT
VALLRFRKTIGEMA