Protein Info for BWI76_RS03450 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 37 to 452 (416 residues), 131.9 bits, see alignment E=4.7e-42 PF13347: MFS_2" amino acids 68 to 413 (346 residues), 41.7 bits, see alignment E=9e-15 PF07690: MFS_1" amino acids 74 to 284 (211 residues), 67.2 bits, see alignment E=1.9e-22 amino acids 275 to 440 (166 residues), 48.4 bits, see alignment E=9.8e-17

Best Hits

Swiss-Prot: 38% identical to SHIA_ECOLI: Shikimate transporter (shiA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 43% identity to mms:mma_0886)

MetaCyc: 38% identical to shikimate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-27

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXT7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BWI76_RS03450 MFS transporter (Klebsiella michiganensis M5al)
MTMLTSPAMTPAKNEQTSQQTHERRKLLTVLGSGLSGTTIEFYDFFIYGTAAALVFPSLF
FPNLSPLMALLVSFLTLSITFVSRPIGAIVFGHYGDKIGRKKSLVLSLMIMGISTFFIGL
IPSYNTIGNAAPLILIFLRLCQGFAIGGEWGGATTLITEYAPRHRRGFFGTFVQLGNVLG
LFIATGVFALVVMLPEEDLMSWGWRVPFLLSIALLFVGMFIRSRIEETPVFQENQKQQQN
APKAAEQKFPILTVLKHHRKAVFLAMGMRMGEIVLGWLTVAFFMSYVTRELNFTRETALN
GLLLASFVGIFTFPFFGWLSDKIGRRPVYLAGAAITLIFAFPLFWMIDSGSVKMFMFATT
FCYSVGLGMMFSVQPAFFSELFDTSVRYTGVSLGFQLANIVGGLTPMIGTLLLVWSGGAS
WPISLFLACMALITILCVCVTRESYNDELNEVKK