Protein Info for BWI76_RS03440 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 274 to 303 (30 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 342 to 375 (34 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 374 (334 residues), 102.1 bits, see alignment E=3.1e-33 PF00083: Sugar_tr" amino acids 59 to 453 (395 residues), 142.4 bits, see alignment E=2.1e-45

Best Hits

KEGG orthology group: None (inferred from 44% identity to bra:BRADO1802)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXT1 at UniProt or InterPro

Protein Sequence (483 amino acids)

>BWI76_RS03440 MFS transporter (Klebsiella michiganensis M5al)
MYQQQHIEFIIQKAKKRLDQQEAPGCTKAGWLMITALLIESWDIYSMAFILFALKDIYEP
SSWLLGFTAAGTQLGAVVGALLGGWLTDKLGRRKIFLWSMILFAIFAVLQGLAPNMYWLA
IIRCLAGIPVGADVANGFTYIMEVMPKGKREVMANRWQFMFALGIIAAILLVTTLVALDV
HPDMIWRIVLAVPAIPACLLLFMRRELPETPAWFVERGRFIEAKKASRDYYGEQDGRLLD
DILPNENVTIADPTLKETLHDLFRRPFTRRTTLFGWFSCAVQSFENYAFSFFLPLILVTI
GISGQIQNNLALLAVNCIAALSAFVGPLLLPKLGHKGLSKYGFLLVTIGISISAWGVYSS
SFAFIIFGAALMLWGHYWDSESGMTVISLVAKPRYRGVASGIGYTIVKVTAFVTTLVFPA
LFEAVGVPIASMIIAIAPFCAFLASIFLLPEVFGHAVGDENDREHDASPAIALEGHESPA
SKH