Protein Info for BWI76_RS03435 in Klebsiella michiganensis M5al

Annotation: mandelate racemase/muconate lactonizing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF02746: MR_MLE_N" amino acids 12 to 131 (120 residues), 50.8 bits, see alignment E=1.9e-17 PF13378: MR_MLE_C" amino acids 153 to 360 (208 residues), 208.4 bits, see alignment E=1.2e-65

Best Hits

KEGG orthology group: None (inferred from 42% identity to sro:Sros_1497)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXZ6 at UniProt or InterPro

Protein Sequence (367 amino acids)

>BWI76_RS03435 mandelate racemase/muconate lactonizing protein (Klebsiella michiganensis M5al)
MNSTKMPVIENIELMTARVPLPEGPWGDQIHHVTDIEVAIVDVYGSNGHVGTGFSHTSGW
CGKTISALIAEIIPDVIGQPLSPRGLWHRSYKHVHDVGGAGVTTHALAALDIAYWDLLGK
TLNAPIIDILGRVRDRVPLYGSGINLHLSIEEVIDQVKRWKSTGYLAAKVKVGKPTLEED
VERLRKIQEAVPGFPLAVDANQGWNFPQALRAFKLFEPLNLLWIEEPMPSDDIAGHLRLR
ERSATPIALGENVYNLNQFTQYIESGSADYIQADLGRVGGITGYLDIAAVARAHNLPMTP
HFVMELSASLLATVPNISYAEMTDGGRWKDLRIIAEAGEEVDGYYVPSERPGHGIILDRD
YLATHKI