Protein Info for BWI76_RS03135 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 197 to 222 (26 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 277 (199 residues), 71.8 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 33% identical to YURN_BACSU: Probable ABC transporter permease protein YurN (yurN) from Bacillus subtilis (strain 168)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 97% identity to kva:Kvar_4572)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX31 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BWI76_RS03135 sugar ABC transporter permease (Klebsiella michiganensis M5al)
MRKTWLPWLILSPSLLFLLLFTWFPLGRSVYDSLFDTRMVSDGGQYVGLENFSRLFADSV
FWQSLVNNLLYILLTVVPGVTLALLLAVALTENHRVNRWLRTAFFFPMIIPMVSAAALWL
FIFMPGLGLLDHYLAKLFGPMNNNWLGRSNSALLALALIGVWKFAGYYMLFFLAGLQSIP
ASTREAAIMEGATRTQVFFKVTLPLLRPTLSFVITTALIYSITQIDHVAVMTRGGPDNAT
TVLLYYIQNLAWDTHDLGKASAATFLTLAGLFAFSLINLKLLEKGAHYER