Protein Info for BWI76_RS03130 in Klebsiella michiganensis M5al

Annotation: putative SN-glycerol-3-phosphate transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 57 (57 residues), see Phobius details transmembrane" amino acids 90 to 115 (26 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 281 (172 residues), 63.6 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to eae:EAE_09855)

Predicted SEED Role

"putative SN-glycerol-3-phosphate transport system permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX30 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BWI76_RS03130 putative SN-glycerol-3-phosphate transport system permease (Klebsiella michiganensis M5al)
MSAEISPLALRSHSASRPLWLRLRRSQPFTLTVLMCCLALLWMSPFLWMLATSFSATTFG
EDMASLLPRMPLTLDNFRDAWDSADWLSLYANTLIFTFGTFFAQLLTITTAGYVFACHEF
RGKKTLFLMFLVQLMIMPVVMMVPNMLTLKTFGLLNTLTGVMMPYFTSAFGVFLMRQAFL
AIPKELEEAALMEGCRWWQVLFRVLLPMSWPSVLAFATVSITYHWNEYLWPLMMLNDPDK
QVLTVGLVSFAMGAESGGQWGIIGAGTLMVCLPLMLAFILFQKQFLRSFGFSGIK