Protein Info for BWI76_RS03120 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 18 to 159 (142 residues), 127 bits, see alignment E=1.7e-40 PF17912: OB_MalK" amino acids 233 to 277 (45 residues), 34.8 bits, see alignment 5.1e-12 PF08402: TOBE_2" amino acids 270 to 342 (73 residues), 47.6 bits, see alignment E=3e-16

Best Hits

KEGG orthology group: None (inferred from 92% identity to kpu:KP1_0566)

Predicted SEED Role

"Probable sugar ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWZ4 at UniProt or InterPro

Protein Sequence (356 amino acids)

>BWI76_RS03120 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MLSLQNISKQFDGKPALSALSLDIREGEFVVLVGPSGCGKSTLLRLLAGLEPVSEGEIWL
HDENITDMSPRERNFAMIFQNYALFPHLSVRDNITFGMKVRKEEKTSWQPRVDKVAQMLQ
LDTLLDRKPAKLSGGQRQRVAMARAIVRNPRLFLMDEPLSNLDARLRSEVRDSIMDLHQQ
LRTSTVYVTHDQTEAMSMADRIVVMNGGHVQQVGRPEYLYANPANLFVAGFIGSPAMNLL
SLPCADGEVLLGELRYPLPPRYREESRVWLGIRPEHISDRVEENHLRLPATVLQRELMGA
DYLLHVSTPIGTLRFSRRHRGAVPEKGDSLILGFSPADVHLFHAEKQHNLAPVHQA