Protein Info for BWI76_RS03110 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 263 to 289 (27 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 406 to 433 (28 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 14 to 468 (455 residues), 393.8 bits, see alignment E=5.7e-122 PF00083: Sugar_tr" amino acids 28 to 470 (443 residues), 385.9 bits, see alignment E=2.8e-119 PF07690: MFS_1" amino acids 34 to 354 (321 residues), 104.9 bits, see alignment E=4.3e-34 amino acids 276 to 466 (191 residues), 38.8 bits, see alignment E=5.6e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_09835)

Predicted SEED Role

"Major myo-inositol transporter IolT" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX53 at UniProt or InterPro

Protein Sequence (499 amino acids)

>BWI76_RS03110 MFS transporter (Klebsiella michiganensis M5al)
MSKEQYLTLNKASGPNSETPTTPFVKVVALIATLGGLLFGYDTGVISGALLFMGTELHLT
PFTTGLVTSSLLFGAAFGALLSGNLANAAGRKKIILWLAVLFAIGAIGTSMAPDVNWMIF
FRLILGVAVGGAAATVPVYIAEIAPANKRGQLVTLQELMIVSGQLLAYISNATFHEVWGG
ESTWRWMLAVATLPAVLLWFGMMFMPDSPRWYAMKGRLAEARRVLERTRHKDDVEWELLE
ITETLDEQRNLGKPRFSEIMTPWLFKLFMIGIGIAVIQQLTGVNTIMYYAPTVLTSVGMT
DNAALFATIANGVVSVLMTFVGIWMLGKIGRRPMTMIGQFGCTACLVFIGAVSYLLPETV
NGQPDALRAYMVLAGMLLFLSFQQGALSPVTWLLMSEIFPTRLRGIFMGGAVFSMWIANF
LISLFFPILLAWLGLSGTFFIFAGIGVFGAIFVIKCVPETRHRSLEQIEHYLRDKLDTSE
EGQAARARRIVAESQANKV