Protein Info for BWI76_RS03105 in Klebsiella michiganensis M5al

Annotation: myo-inosose-2 dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR04379: myo-inosose-2 dehydratase" amino acids 5 to 296 (292 residues), 390.3 bits, see alignment E=3.3e-121 PF01261: AP_endonuc_2" amino acids 37 to 295 (259 residues), 123.5 bits, see alignment E=6.2e-40

Best Hits

Swiss-Prot: 96% identical to IOLE_KLEP7: Inosose dehydratase (iolE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 96% identity to kpe:KPK_4988)

MetaCyc: 93% identical to myo-inosose-2 dehydratase (Klebsiella aerogenes)
Myo-inosose-2 dehydratase. [EC: 4.2.1.44]

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.44

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX17 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS03105 myo-inosose-2 dehydratase (Klebsiella michiganensis M5al)
MNKDNVKLAIAPIGWTNDDMPELGSENTFQQIVSEMALAGFTGSEVGSKYPRDPAVLKPM
LDIRGIQICNAWFSTFFANGQREKTIDEFVNHMNFLHAMGAKVIGCSEQSGSIQGLEKPI
LENAKPCFSEEEWQRVAEGYNTLGRLAAEKGMQVCLHHHMGTGIQTTAEIDKFMSLVDDK
VFLLYDTGHAWYSEGGEEPMLAILKKYLPRINHVHLKDVRPPVIEQVRREGLSFLDGVKK
GTFTVPGDGVIDFRPVFKLLDEHGYKGWMVVEAEQDPALANPFEYAVKARKYIRETAGI