Protein Info for BWI76_RS03100 in Klebsiella michiganensis M5al

Annotation: protein iolH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF01261: AP_endonuc_2" amino acids 20 to 253 (234 residues), 155.1 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 52% identical to IOLH_BACSU: Protein IolH (iolH) from Bacillus subtilis (strain 168)

KEGG orthology group: K06605, myo-inositol catabolism protein IolH (inferred from 98% identity to kpn:KPN_04676)

Predicted SEED Role

"Glyceraldehyde-3-phosphate ketol-isomerase (EC 5.3.1.1)" in subsystem Inositol catabolism (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWX5 at UniProt or InterPro

Protein Sequence (294 amino acids)

>BWI76_RS03100 protein iolH (Klebsiella michiganensis M5al)
MKIAFDVDVIKDLGVTRMVHQVAEWGYKYIEQSPHPQINPFYKHPRASREIMAEYKQALR
DTGVELSSFICVYRWSGPDELRRQAAVKNWKRLIEIAVEMGVQVINTEFSGDPNQPEICD
EMFYRSMEELLPIFEREGIRVEIQAHPWDFCEENNETVDIVKSFRSDNVKYVYSVPHTFF
YDKGVGDVEKMLRYAGSDLSHVLIADTRNHTKHCRYIVNPPGVDAVVHQHVGVGEGDVDF
DALFRTLRDMKFAEQTFKVGGEPIVATSLFGYPEKMKYQAVETRELIERELLRR