Protein Info for BWI76_RS03080 in Klebsiella michiganensis M5al

Annotation: (Fe-S)-cluster assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01418: HTH_6" amino acids 12 to 82 (71 residues), 47.3 bits, see alignment E=1.7e-16 PF01380: SIS" amino acids 144 to 272 (129 residues), 80.6 bits, see alignment E=9.7e-27

Best Hits

KEGG orthology group: None (inferred from 95% identity to kpe:KPK_4995)

Predicted SEED Role

"Predicted transcriptional regulator of the myo-inositol catabolic operon" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX22 at UniProt or InterPro

Protein Sequence (285 amino acids)

>BWI76_RS03080 (Fe-S)-cluster assembly protein (Klebsiella michiganensis M5al)
MANNPTQLTILQDEIRRRYDTLSKRLKQVARYILDNSNSVAFDTVASIAQQADVPPSTLI
RFANAFGFSGFNEMKQMFKQHLMEETANYTERARLFRQTTTDDATPPETPTEILNMFTMV
NTQALQQLAMQTSGDDLQRAVALLAEAENIYVIGLRRSFSVASYLTYALRHLDRKAFLID
GLGGMFTEQLSLVGPKDVVVAVSFSPYAREVVELVELGAQRKARQIAITDSQVSPLAAFS
DVCFVVREAQVDGFRSQVASLCLAQTLAVSLALNSSKDAETKQLA