Protein Info for BWI76_RS03055 in Klebsiella michiganensis M5al

Annotation: LPS export ABC transporter permease LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 6 to 358 (353 residues), 452.5 bits, see alignment E=3.6e-140 PF03739: LptF_LptG" amino acids 9 to 358 (350 residues), 297 bits, see alignment E=9.1e-93

Best Hits

Swiss-Prot: 92% identical to LPTG_ECOL6: Lipopolysaccharide export system permease protein LptG (lptG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 96% identity to kpn:KPN_04667)

MetaCyc: 93% identical to lipopolysaccharide ABC transporter permease (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"FIG000906: Predicted Permease"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX07 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BWI76_RS03055 LPS export ABC transporter permease LptG (Klebsiella michiganensis M5al)
MQAFGVLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLKKAGQGNYDALGAGIYTILSV
PKDIQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRLQVALSVMKTAIPLVLLTMAI
GEWVAPQGEQMARNYRAQQMYGGSLLSTQQGLWAKDGHNFVYIERVKGSDELGGVSIYAF
NDQRRLQSVRYAASAKFDTENKLWRLSQVDESNLTDPKQVTGTQTVSGTWKTNLTPDKLG
VVALDPDALSISGLHNYVTYLKSSGQDPGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPL
RSVPMGVRVVTGISFGFIFYVLDQIFGPLTLVYGIPPIIGALLPSASFFLLSLWLMMRKS