Protein Info for BWI76_RS03025 in Klebsiella michiganensis M5al

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13302: Acetyltransf_3" amino acids 9 to 145 (137 residues), 33.8 bits, see alignment E=1.1e-11 PF00583: Acetyltransf_1" amino acids 42 to 144 (103 residues), 67.3 bits, see alignment E=2.9e-22 PF13673: Acetyltransf_10" amino acids 49 to 148 (100 residues), 36.9 bits, see alignment E=6.8e-13 PF13508: Acetyltransf_7" amino acids 59 to 145 (87 residues), 48.7 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 82% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_09750)

MetaCyc: 82% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"Aspartate N-acetyltransferase (EC 2.3.1.17)" (EC 2.3.1.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX11 at UniProt or InterPro

Protein Sequence (167 amino acids)

>BWI76_RS03025 N-acetyltransferase (Klebsiella michiganensis M5al)
MNTSATLPLTLRRITANDNPAIANVIRQVSAEYGLTADKGYTVADPNLDQLYELYSQPGS
AYWVVELNGEVVGGGGVAPLSCSEPDICELQKMYFMTSARGRGLAKKLALMALDYAREQG
FKRCYLETTAFLKEAVGLYEHLGFEHIDGPLGCTGHVDCEVTMLKVL