Protein Info for BWI76_RS03025 in Klebsiella michiganensis M5al
Annotation: N-acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 82% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 92% identity to eae:EAE_09750)MetaCyc: 82% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39
Predicted SEED Role
"Aspartate N-acetyltransferase (EC 2.3.1.17)" (EC 2.3.1.17)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AX11 at UniProt or InterPro
Protein Sequence (167 amino acids)
>BWI76_RS03025 N-acetyltransferase (Klebsiella michiganensis M5al) MNTSATLPLTLRRITANDNPAIANVIRQVSAEYGLTADKGYTVADPNLDQLYELYSQPGS AYWVVELNGEVVGGGGVAPLSCSEPDICELQKMYFMTSARGRGLAKKLALMALDYAREQG FKRCYLETTAFLKEAVGLYEHLGFEHIDGPLGCTGHVDCEVTMLKVL