Protein Info for BWI76_RS03010 in Klebsiella michiganensis M5al

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to OTC_ECOLC: Ornithine carbamoyltransferase (argI) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 93% identity to kpu:KP1_0539)

MetaCyc: 90% identical to CP4-6 prophage; ornithine carbamoyltransferase ArgF (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

superpathway of arginine and polyamine biosynthesis (16/17 steps found)
L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
L-citrulline degradation (3/3 steps found)
L-citrulline biosynthesis (6/8 steps found)
L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
urea cycle (3/5 steps found)
superpathway of L-citrulline metabolism (8/12 steps found)
L-arginine biosynthesis IV (archaea) (4/9 steps found)
L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWW8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>BWI76_RS03010 ornithine carbamoyltransferase (Klebsiella michiganensis M5al)
MSAFYQKHFLKLLDFTPAEITALLELAARLKADKKNNIEIQHLTGKNIALIFEKDSTRTR
CSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAEY
AGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNQMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPTACWPEEKLVEQCRALAQKNGGNITLTEDIAAGVKGADFIYTDVWVSMGEA
KEKWAERIALLRAYQVNSEMMALTGNPQVKFLHCLPAFHDDQTTLGKQMAAEYGLHGGME
VTDEVFESAASIVFDQAENRMHTIKAVMVATLGK