Protein Info for BWI76_RS02970 in Klebsiella michiganensis M5al

Annotation: trehalose operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR02405: trehalose operon repressor" amino acids 4 to 314 (311 residues), 540 bits, see alignment E=9.1e-167 PF00356: LacI" amino acids 6 to 51 (46 residues), 74.4 bits, see alignment 7.2e-25 PF00532: Peripla_BP_1" amino acids 87 to 312 (226 residues), 47.1 bits, see alignment E=3.4e-16 PF13377: Peripla_BP_3" amino acids 168 to 311 (144 residues), 69.9 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 82% identical to TRER_SALTY: HTH-type transcriptional regulator TreR (treR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_09700)

Predicted SEED Role

"Trehalose operon transcriptional repressor" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWZ9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BWI76_RS02970 trehalose operon repressor (Klebsiella michiganensis M5al)
MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMQQHGFSPSRSARAMRGQ
SDKVVAIIVTRLDSLSENLAVQTMLPAFYAQGYDPIMMESQFSPALVEEHLGMLARRNID
GVVLFGFTGIQQEMLTPWRETLVLLARDAPGIASVCYDDEGSIRMLMQRLYDRGHRHISF
LGVPHSDVTTGQRRHQAYLDFCLKKRLTPLAALPGLGMKQGYESVAEVLSAETSALVCAT
DTLALGASKYLQQQGIDRLQLASVGSTPLMKFLHPEILTVDPGYAESGRQAAQQLIEQIA
GNREPRQIVIPAVLN