Protein Info for BWI76_RS02895 in Klebsiella michiganensis M5al
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 93% identity to kpn:KPN_04640)Predicted SEED Role
"2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14) in D-glucosaminate utilization operon" (EC 4.1.2.14)
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- Entner-Doudoroff pathway I (9/9 steps found)
- superpathway of hexuronide and hexuronate degradation (9/10 steps found)
- 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
- D-galacturonate degradation I (5/5 steps found)
- D-fructuronate degradation (4/4 steps found)
- superpathway of β-D-glucuronosides degradation (6/7 steps found)
- Entner-Doudoroff shunt (2/2 steps found)
- D-glucosaminate degradation (2/3 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
- 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.14
Use Curated BLAST to search for 4.1.2.14
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AWU6 at UniProt or InterPro
Protein Sequence (246 amino acids)
>BWI76_RS02895 hypothetical protein (Klebsiella michiganensis M5al) MKLTPNFYRDRVCLNVLAGSKDNASEIYEAAEGHVLVGVLSKNYPDVASAVADMREYALR IDNALSVGLGAGDPNQSAMVSEISRQVQPQHVNQVFTGVATSRALLGQNDTVVNGLVSPT GTPGMVKISTGPLSSGAPDGIVPLETAIALLKDMGGSSIKYFPMGGLKHRDEFIAVAEAC ARYDFWLEPTGGIDLENYGEILQIALDAGVSKIIPHIYSSIIDKASGNTRPADVRQLLSI TKQLVK