Protein Info for BWI76_RS02890 in Klebsiella michiganensis M5al

Annotation: L-seryl-tRNA selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR01437: uncharacterized pyridoxal phosphate-dependent enzyme" amino acids 4 to 365 (362 residues), 606.3 bits, see alignment E=8.7e-187 PF03841: SelA" amino acids 21 to 320 (300 residues), 49 bits, see alignment E=7e-17

Best Hits

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 94% identity to kva:Kvar_4610)

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.9.1.1

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AX09 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BWI76_RS02890 L-seryl-tRNA selenium transferase (Klebsiella michiganensis M5al)
MPSIFEKYDLKQVINTSGRMTILGVSTPRPEVVEAAMAGMNQYFEMKDLVNKTGAYIAKL
LDVEGATVVSCASAGIAQSVAAVLVKDSDWLLENLHVTPIENNEIVLPKGHNVNFGAPVG
TMVALGGGRLVEAGYANECSAGQLAAAITPRTAAILYIKSHHCVQKSMLNVAQAAAVAQR
HNLPLIVDAAAEEDLQAYYRAGADLVIYSGAKAIEGPTSGLVIGKTQYVEWVKRQSNGIG
RAMKVGKEGILGLTCAIEHYLTASKESGEQMVAKMTPFIQQLNTLNGVTARVVWDSAGRD
IARAEIKFDEAVTGVNTGDLVNALKQGEYAIYFRGYKANEGIIEADVRSVNAQQLEIVSR
RIAEVLNKEKNA