Protein Info for BWI76_RS02885 in Klebsiella michiganensis M5al

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR03583: putative amidohydrolase, EF_0837/AHA_3915 family" amino acids 3 to 364 (362 residues), 577.8 bits, see alignment E=4.5e-178 PF01979: Amidohydro_1" amino acids 47 to 334 (288 residues), 42.7 bits, see alignment E=4.6e-15

Best Hits

Swiss-Prot: 49% identical to DEACT_ENTFA: Deacetylase EF_0837 (EF_0837) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_09635)

Predicted SEED Role

"Metallo-dependent hydrolases, subgroup B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWX6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BWI76_RS02885 dihydroorotase (Klebsiella michiganensis M5al)
MFDLLLRRARLVDDTLTDIAIRDGKIAALGEISAPARKTIALDGSCYVSAGWIDSHVHCY
PNSPIYHDEPDSVGIATGVTTVIDAGSTGADDVDDFYQLTREAATEVYALLNISRVGLIA
QNELANMANIDAEAVKQAVNRYPNFIVGLKARMSSSVVGENGITPLARAKAMQQENGGLP
LMVHIGNNPPDLDEIADRLTSGDIITHCYNGKPNRILTPSGELKSAITRALQRGVRLDIG
HGTASFSFEVARRAIAMGILPHTISSDIYCRNRIDGPVRSLALVMSKFLAIGMSLPQVID
CVTANAADGLRLTHKGRLEVGYDADLTLFTLAQTPTVLVDAEKESLQTDTILQPLAAVRA
GKGYLTEQGSAENAFDF