Protein Info for BWI76_RS02880 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 160 to 188 (29 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details PF14187: DUF4310" amino acids 4 to 211 (208 residues), 357.1 bits, see alignment E=1.6e-111 TIGR03579: conserved hypothetical protein EF_0833/AHA_3914" amino acids 5 to 213 (209 residues), 389.9 bits, see alignment E=1.6e-121

Best Hits

KEGG orthology group: None (inferred from 94% identity to sek:SSPA3942)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWT8 at UniProt or InterPro

Protein Sequence (214 amino acids)

>BWI76_RS02880 membrane protein (Klebsiella michiganensis M5al)
MEQNKGFWYADWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVAFVAMLKAGIDTGAYGA
VAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLGAGFVFPVANFAASLATGL
VLGLAIGYIIILARKFTINQSDSTYGADVMMGAGNASGRFLGPLIILSAMAASIPIGIGS
LAGALLFYIWQKPITGGAILGAMLLGSIFPVAIS