Protein Info for BWI76_RS02850 in Klebsiella michiganensis M5al

Annotation: metalloprotease PmbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF01523: PmbA_TldD_1st" amino acids 36 to 100 (65 residues), 49.1 bits, see alignment E=8e-17 PF19290: PmbA_TldD_2nd" amino acids 128 to 234 (107 residues), 79.1 bits, see alignment E=5.7e-26 PF19289: PmbA_TldD_3rd" amino acids 242 to 449 (208 residues), 243.2 bits, see alignment E=2.7e-76

Best Hits

Swiss-Prot: 92% identical to PMBA_ECO57: Metalloprotease PmbA (pmbA) from Escherichia coli O157:H7

KEGG orthology group: K03592, PmbA protein (inferred from 96% identity to kpu:KP1_0505)

MetaCyc: 92% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWT6 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BWI76_RS02850 metalloprotease PmbA (Klebsiella michiganensis M5al)
MALAMKVISQVAQQRKTLEEAVTTALELAAGKSDGAEVSVSKTTGIGVSTRYGEVENVEF
NSDGALGITVYHQNRKGSASSTDLSPQAIARTVQAALDIARYTSPDPCAGVADKELLAFE
APDLDLFHPAEVSPDEAIELASRAEQAALKADKRISNTEGGSFNSHYGIKVFGNSHGMLQ
SYCSTRHSLSSCVIAEENGDMERDYAYTIGRAIDDLQSPEWVGEECARRTLSRLAPRKLS
TMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDALGSQILPEWLTIEEHPHLLKG
LASTPFDSEGVRTERRDIIKDGVLTQWLLTNYSARKLGLKSTGHAGGIHNWRINGRGLSF
AKLLKEMGTGLVVTELMGQGVSGVTGDYSRGASGFWVENGEIQYPVSEITIAGNLKDMWR
NIVTIGDDIETRSNIQCGSVLLPEMKIAGQ