Protein Info for BWI76_RS02770 in Klebsiella michiganensis M5al

Annotation: peptide-methionine (S)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 44 to 199 (156 residues), 236.3 bits, see alignment E=9e-75 PF01625: PMSR" amino acids 45 to 200 (156 residues), 205.1 bits, see alignment E=4.3e-65

Best Hits

Swiss-Prot: 94% identical to MSRA_KLEP3: Peptide methionine sulfoxide reductase MsrA (msrA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 94% identity to kpe:KPK_5049)

MetaCyc: 90% identical to methionine sulfoxide reductase A (Escherichia coli K-12 substr. MG1655)
L-methionine (S)-S-oxide reductase. [EC: 1.8.4.13]; Peptide-methionine (S)-S-oxide reductase. [EC: 1.8.4.13, 1.8.4.11]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWV8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BWI76_RS02770 peptide-methionine (S)-S-oxide reductase (Klebsiella michiganensis M5al)
MSLFDKTHLVAQADALPGRNTPMPVATLHAVNGHSMTNVPAGMEIALFAMGCFWGVERLF
WQLPGVYSTAAGYTGGYTPNPTYREVCSGETGHAEAVRVVYDPQVISYEQLLQVFWENHD
PAQGMQQGNDRGTQYRSAIYPLTPEQSEAAQASLARFQAAMNEANDTRTITTEIATAKPF
YYAEDDHQQYLHKNPYGYCGIGGIGVCLPPQA