Protein Info for BWI76_RS02760 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF01306: LacY_symp" amino acids 4 to 403 (400 residues), 461.7 bits, see alignment E=4.4e-142 TIGR00882: oligosaccharide:H+ symporter" amino acids 5 to 396 (392 residues), 455.9 bits, see alignment E=5.9e-141 PF12832: MFS_1_like" amino acids 13 to 359 (347 residues), 72 bits, see alignment E=9.9e-24 PF07690: MFS_1" amino acids 13 to 332 (320 residues), 66.5 bits, see alignment E=4.2e-22

Best Hits

KEGG orthology group: None (inferred from 93% identity to kva:Kvar_4642)

Predicted SEED Role

"Lactose permease" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Lactose and Galactose Uptake and Utilization or Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWS5 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BWI76_RS02760 MFS transporter (Klebsiella michiganensis M5al)
MIESNKNYYISCLFFLFFFIGWGCCYPYLSLWLTETIGINYTDVGLVYSFTAVIAVCVQP
LFGFISDRLVYRKNLMWMLAIIITLFAPYWIYVFAPLLKVNVFLGALAGGIYIGMAYGAG
CGICEAYIDKVSRASGFEFGRARMFGGIGAAIGTFAAGKLYGIDQNMIFWLASCAGVCLL
VIVWKMQISAHKQDAMQSRKASPVTLSDAASLLKMKKFWFFAIYTIGVGAVYETYDQQFA
IYYSHFFESKARGAEVFGYLTTGQIFLDAVVMFFAPWFVNKIGPKNALLYCGMIMSLRII
GSAWAMGPVSISLIKLLHGFESSVLLVAALKYITANFNPLLSATVYLIGFQFSKSFSSIF
LSTGIGHMYQSMGFTSSYIVLGGIALCFTLISFITLDKARAFAPQPAPAH