Protein Info for BWI76_RS02715 in Klebsiella michiganensis M5al

Annotation: putative helix-turn-helix AraC-type transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF02311: AraC_binding" amino acids 24 to 149 (126 residues), 86.1 bits, see alignment E=2.8e-28 PF00165: HTH_AraC" amino acids 179 to 219 (41 residues), 31 bits, see alignment 3.2e-11 amino acids 238 to 268 (31 residues), 31.5 bits, see alignment 2.3e-11 PF12833: HTH_18" amino acids 192 to 270 (79 residues), 74.1 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_09490)

Predicted SEED Role

"L-rhamnose operon transcriptional activator RhaR" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWV0 at UniProt or InterPro

Protein Sequence (274 amino acids)

>BWI76_RS02715 putative helix-turn-helix AraC-type transcriptional regulator (Klebsiella michiganensis M5al)
MQGVPEQFNDERDSARFRHLAQLPGVELYHAHISRYAFEPHTHEAFGIGAIELGAERFRY
RGSQHVASVNSIVTMNPDELHTGEAETADGWRYRMIYLDPDTLEEVTGERHWWFSEVVRQ
DPLRSRQIGNLIYGLWHTDDPLAQQGLLLDLIDTFRPFAHHAAALPEARHRFERVRDYLH
DNYMRTVTLDELAQVAALSPYHFQRQFKAHFYVTPHQMLMAIRLWRAKAFLTHGMPAADV
ALAAGLTDQSHLTRAFTRRYGITPVRYQKQVLPR