Protein Info for BWI76_RS02685 in Klebsiella michiganensis M5al

Annotation: opacity-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF08525: OapA_N" amino acids 23 to 50 (28 residues), 33.2 bits, see alignment (E = 3.7e-12) PF04225: OapA" amino acids 134 to 218 (85 residues), 117.7 bits, see alignment E=1.9e-38

Best Hits

KEGG orthology group: K07269, hypothetical protein (inferred from 86% identity to kva:Kvar_4656)

Predicted SEED Role

"Putative cell envelope opacity-associated protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWP8 at UniProt or InterPro

Protein Sequence (219 amino acids)

>BWI76_RS02685 opacity-associated protein (Klebsiella michiganensis M5al)
MPGRFELTSTLAKIWHAPDHFRLMDPLPPMHRRGIIAGALLVIIGVLLPSEDNSSEVQAS
REANLNLQSQSQPSSGNQAVPLPPITNTPPVNDADQVAPVAPEPIQDEQPDQPQQQAASQ
PYQEPQSTPGIEQQWRTYRIESGKTLAQLFRDHNLPPTDVYAMAQVEGAGKPLSSLQTGQ
TVQIRQNANGVVTGLTIDTGGGQQVLFTRQSNGSFIRVR