Protein Info for BWI76_RS02650 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 367 to 367 (1 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 258 (238 residues), 90.1 bits, see alignment E=2.1e-29 amino acids 243 to 385 (143 residues), 59.1 bits, see alignment E=5.6e-20 PF00083: Sugar_tr" amino acids 47 to 188 (142 residues), 24.8 bits, see alignment E=1.5e-09 amino acids 221 to 358 (138 residues), 34.6 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: None (inferred from 91% identity to kpn:KPN_04592)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWW4 at UniProt or InterPro

Protein Sequence (397 amino acids)

>BWI76_RS02650 MFS transporter (Klebsiella michiganensis M5al)
MVPRFATLSRIPKGVWVLGGVSLLMDVSSEMIHSLLPLFMATTLGASVIIIGIIEGVAEA
TALMLKVFSGVISDYVGKRKGLALLGYGLGALSKPLFAIAPTSGVVFSARMIDRVGKGIR
GAPRDALVADVTPPEIRGAAYGLRQALDTIGAFLGPLLAVALMFLWDNDFQSIFWVAVIP
AALSIALLGFGLKEPKTPITRKRTNPLRRENLKKLSAAYWWVVVIGSIFTLARFSEAFLV
LRAQQMAIPLFAIPLVMVAMNLVYSLTAYPFGKLSDSMSHSKMLQWGLLVLIAADIVLAL
SSHWSTLLAGVALWGIHMGMTQGLLAAMVAHTAPPELRGTAFGMFNLMSGVALLLASAGA
GVLWEVFGAASTFYAGAVICVLTLIGMRCMPSAYQQN