Protein Info for BWI76_RS02620 in Klebsiella michiganensis M5al

Annotation: PTS ascorbate transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 305 to 331 (27 residues), see Phobius details amino acids 335 to 362 (28 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details PF03611: EIIC-GAT" amino acids 15 to 406 (392 residues), 359.1 bits, see alignment E=1.6e-111

Best Hits

Swiss-Prot: 97% identical to ULAA_SALCH: Ascorbate-specific PTS system EIIC component (ulaA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 96% identity to eco:b4193)

MetaCyc: 96% identical to L-ascorbate specific PTS enzyme IIC component (Escherichia coli K-12 substr. MG1655)
RXN0-2461 [EC: 2.7.1.194]

Predicted SEED Role

"Ascorbate-specific PTS system, EIIC component" in subsystem L-ascorbate utilization (and related gene clusters)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.194

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWS8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>BWI76_RS02620 PTS ascorbate transporter subunit IIC (Klebsiella michiganensis M5al)
MEILYHIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSASVIVKGTIKTIIGFMLLQAGSG
ILTSTFKPVVAKMSEVYGINGAISDTYASMMATIERMGDAYSWVGYAVLLALALNICYVL
LRRITGIRTIMLTGHIMFQQAGLIAVFFYIFGYPMWTTIICTAVLVSLYWGITSNMMYKP
TQEVTDGCGFSIGHQQQFASWIAYKVAPYLGKKEESVEDLKLPGWLNIFHDNIVSTAIVM
TIFFGAILLSFGIDTVQAMAGKTHWTIYILQTGFSFAVAIFIITQGVRMFVAELSEAFNG
ISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGTIGQLIAVGILVGFGSSILIIPGFIPM
FFSNATIGVFANHFGGWRAALKICLVMGMIEIFGCVWAVKLTGMSAWMGMADWSILAPPM
MQGFASIGIAFMAVIIIIALAYMFFAGRTLRAEEDAEKQLADASAQ