Protein Info for BWI76_RS02605 in Klebsiella michiganensis M5al

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF01738: DLH" amino acids 17 to 207 (191 residues), 28.2 bits, see alignment E=5.4e-10 PF00756: Esterase" amino acids 19 to 169 (151 residues), 30.2 bits, see alignment E=1.6e-10 PF12146: Hydrolase_4" amino acids 28 to 139 (112 residues), 37.4 bits, see alignment E=7.4e-13 PF00561: Abhydrolase_1" amino acids 29 to 177 (149 residues), 36.2 bits, see alignment E=2.1e-12 PF12697: Abhydrolase_6" amino acids 30 to 186 (157 residues), 27.3 bits, see alignment E=2.3e-09 PF00326: Peptidase_S9" amino acids 85 to 238 (154 residues), 54 bits, see alignment E=6.9e-18

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 82% identity to kpn:KPN_04583)

Predicted SEED Role

"YjfP protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWN3 at UniProt or InterPro

Protein Sequence (238 amino acids)

>BWI76_RS02605 esterase (Klebsiella michiganensis M5al)
MIALEMRNLAGGEVLHAYPQGAADTPLPCIVFYHGFTSSKLVYSYFAVALAEAGFRVIMP
DAAEHGARYRGDEQGRMQRFWPILTHNFVEFPALQEAIREQGWLAGDRLAVAGASMGGMT
ALGIMTHHPELKSVACLMGSGYFSTLSQTLFPSPSWEAGQLAEWDVSQQLATLASRPLLL
WHGDEDDVVPPGETFRLQQALQQNALADNLTCIWQKGVRHRITPEALAATVAFFQRHL