Protein Info for BWI76_RS02525 in Klebsiella michiganensis M5al

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 311 (311 residues), 346.7 bits, see alignment E=8.4e-108 PF02518: HATPase_c" amino acids 21 to 77 (57 residues), 32.8 bits, see alignment 1.6e-11 PF13589: HATPase_c_3" amino acids 24 to 122 (99 residues), 52.9 bits, see alignment E=7.9e-18 PF01119: DNA_mis_repair" amino acids 214 to 330 (117 residues), 121 bits, see alignment E=4.5e-39 PF08676: MutL_C" amino acids 456 to 585 (130 residues), 94.4 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 85% identical to MUTL_KLEP7: DNA mismatch repair protein MutL (mutL) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_09305)

MetaCyc: 82% identical to DNA mismatch repair protein MutL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWR2 at UniProt or InterPro

Protein Sequence (631 amino acids)

>BWI76_RS02525 DNA mismatch repair protein MutL (Klebsiella michiganensis M5al)
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNG
CGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVARLTLTSRTEDQQEA
WQAYAEGRDQAVTVKPAAHPVGTTLEVLDLFYNTPARRKFMRTEKTEFGHIDEIVRRIAL
ARFDVTINLSHNGKVVRQYRAVSQDGQRERRLGAICGLPFLEHALAIEWQHGDLTLSGWV
ADPLHTNPTLAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLKIDPHQVD
VNVHPAKHEVRFHQSRLVHDFIYQGVLSILQQQLEVPLAKEGGEPALRQVPENRVAAGGN
HFAQPAVARENAAPRYRDEPAAPRFNAGGSREPAASGSSSTDGAGWPHAQPGYQKQQGAL
YRQLLDTPAAERKPKSPAPAAEGLSGHSQSFGRVLTIIDSDCALLERDGKLALLALPVAE
RWLRQAQLTPGAEAVCAQPLLIPLRIKVSEEEKDALKQAQSALAEVGIELQSDAHHVTIR
AVPLPLRQQNLQILIPELIGYLAQQKTVDVGNIAQWMARNLASEHAQWNMAQAIAVLADI
ERLCPQLVKAPPGGLLQPVDLHSAMNALKDE