Protein Info for BWI76_RS02515 in Klebsiella michiganensis M5al

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE
  • amino acids 8 to 140 (133 residues), 191.4 bits, E=2.9e-61
• PF02367: TsaE
  • amino acids 9 to 133 (125 residues), 142 bits, E=5e-46

Best Hits

Swiss-Prot: 90% identical to TSAE_SHIFL: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Shigella flexneri

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 93% identity to kpu:KP1_0436)

MetaCyc: 90% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234

Sequence Analysis Tools

See A0A285AWQ9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>BWI76_RS02515 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE (Klebsiella michiganensis M5al)
MINRVIPLPDEQATLSLGNRVAQACTGATVIYLYGDLGAGKTTFSRGFLQALGHRGNVKS
PTYTLVEPYSLENLMVYHFDLYRLADPEELEFMGIRDYFTDDAICLVEWPQQGTGVLPDP
DVEIHLEYQAQGREARVTAVSSLGESLLARLAN