Protein Info for BWI76_RS02505 in Klebsiella michiganensis M5al

Annotation: tRNA epoxyqueuosine(34) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00276: epoxyqueuosine reductase" amino acids 14 to 348 (335 residues), 509.2 bits, see alignment E=2.4e-157 PF08331: QueG_DUF1730" amino acids 62 to 140 (79 residues), 83.7 bits, see alignment E=7e-28 PF13484: Fer4_16" amino acids 192 to 256 (65 residues), 79.4 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 87% identical to QUEG_ECOLI: Epoxyqueuosine reductase (queG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_09285)

MetaCyc: 87% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWL6 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BWI76_RS02505 tRNA epoxyqueuosine(34) reductase QueG (Klebsiella michiganensis M5al)
MSQPLDLNHLAQQIKQWGTELGFQQVGITDTDLSTSEPKLQAWLDKQYHGEMEWMARHGM
MRARPHELQPGTLRVISVRMNYLPANAAFARTLKDPARGYVSRYALGRDYHKLLRHRLKK
LGEMIQAQCASLNFRPFVDSAPILERPLAEKAGLGWTGKHSLILSRDAGSFFFLGELLID
LPLPIDQPVEEECGRCVACMTICPTGAIVEPYTVDARRCISYLTIELEGAIPEEFRPLIG
NRIYGCDDCQLICPWNRFAQLTDEDDFSPRKALHAPELLELFTWSESYFLKVTEGSAIRR
IGHLRWLRNIAVALGNAPWDEANLKALESRRGEHPLLDEHIEWAMTQQMAKRNANVVEVQ
LPKKLRLVRVVEKGLPRDA