Protein Info for BWI76_RS02450 in Klebsiella michiganensis M5al

Annotation: succinate dehydrogenase/fumarate reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13085: Fer2_3
  • amino acids 8 to 111 (104 residues), 110 bits, E=1.8e-35
• TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein
  • amino acids 11 to 229 (219 residues), 319.4 bits, E=5.3e-100
• PF13237: Fer4_10
  • amino acids 144 to 216 (73 residues), 46.6 bits, E=8.5e-16
• PF13183: Fer4_8
  • amino acids 147 to 219 (73 residues), 45.2 bits, E=3.5e-15
• PF12838: Fer4_7
  • amino acids 149 to 218 (70 residues), 31.7 bits, E=5.2e-11
• PF13534: Fer4_17
  • amino acids 149 to 220 (72 residues), 32.7 bits, E=2.6e-11

Best Hits

Swiss-Prot: 94% identical to FRDB_ECOL6: Fumarate reductase iron-sulfur subunit (frdB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 95% identity to esc:Entcl_3999)

MetaCyc: 94% identical to fumarate reductase iron-sulfur protein (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• NADH to fumarate electron transfer (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• hydrogen to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• L-glutamate degradation VIII (to propanoate) (7/11 steps found)
• reductive TCA cycle II (7/12 steps found)
• methylaspartate cycle (12/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

See A0A285AWK4 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BWI76_RS02450 succinate dehydrogenase/fumarate reductase iron-sulfur subunit (Klebsiella michiganensis M5al)
MAEMKNMKVEVVRYNPEVDIAPHSAFYEVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNKVPKLACKTFLREYTKGIKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNPRTPDQGPNTQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNGQNGVWTCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR