Protein Info for BWI76_RS02440 in Klebsiella michiganensis M5al

Annotation: fumarate reductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details PF02313: Fumarate_red_D" amino acids 6 to 116 (111 residues), 160.8 bits, see alignment E=7e-52

Best Hits

Swiss-Prot: 94% identical to FRDD_KLEP3: Fumarate reductase subunit D (frdD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00247, fumarate reductase subunit D (inferred from 94% identity to kva:Kvar_4701)

MetaCyc: 87% identical to fumarate reductase membrane protein FrdD (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit D" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWN4 at UniProt or InterPro

Protein Sequence (119 amino acids)

>BWI76_RS02440 fumarate reductase subunit D (Klebsiella michiganensis M5al)
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLAPADAFSYERVLAFAH
SFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFYGLAAILTVVTLVGILFI