Protein Info for BWI76_RS02265 in Klebsiella michiganensis M5al

Annotation: putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 14 to 186 (173 residues), 220.3 bits, see alignment E=7.3e-70 PF03741: TerC" amino acids 15 to 185 (171 residues), 164.3 bits, see alignment E=1.3e-52

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_08795)

Predicted SEED Role

"FIG00731756: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWK7 at UniProt or InterPro

Protein Sequence (226 amino acids)

>BWI76_RS02265 putative transmembrane protein (Klebsiella michiganensis M5al)
MNEFFSQWDVAVILLQIIAIDLLLGGDNAVVIAMACRKLPPQQRTKAIIIGTFGAIAARV
LLLAVAIYLLSLPWLKVVGALMLLWIGIKLVTNQEEESEVSSYSSLWRTAVTITVADVIM
SLDNVLAVAAAGKGHLLLVALGVLISIPIIVLGSKLVLAILNRFPSVVMLGGALIGWIAG
SMMVTDVTIVHLFPNAPAALPLMGGTIGAALVLLEGLRRNRRRSTE