Protein Info for BWI76_RS02260 in Klebsiella michiganensis M5al

Annotation: DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00226: DnaJ" amino acids 5 to 66 (62 residues), 81.3 bits, see alignment E=4.5e-27 PF01556: DnaJ_C" amino acids 120 to 276 (157 residues), 138.6 bits, see alignment E=1.9e-44

Best Hits

Swiss-Prot: 82% identical to CBPA_ECO7I: Curved DNA-binding protein (cbpA) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K05516, curved DNA-binding protein (inferred from 91% identity to kpn:KPN_04509)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWI1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BWI76_RS02260 DNA-binding protein (Klebsiella michiganensis M5al)
MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDDQ
RRAEYDQLWQHRNDPQFGRQQQHSREQSYSQQDFDDIFSTMFGQQAHHSRRQHGVRGHDL
EIEVAVFLEETLAEQTRTISYKLPVYNVFGMVESETPKTLNVKIPAGVVDGQRIRLKGQG
TPGENGGPNGDLWLVIHIAPHPLFDVVGHNLEIVLPLAPWEAALGAKVTIPTLKESILLT
IPPGSQAGQRLRVKGKGLTSKTTTGDLYAVIKIVMPPKPDEKSRALWQQLADAQSSFEPR
KTWGKA