Protein Info for BWI76_RS02240 in Klebsiella michiganensis M5al

Annotation: alkylphosphonate utilization operon protein PhnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF08274: Zn_Ribbon_YjdM" amino acids 2 to 31 (30 residues), 61.8 bits, see alignment E=4.9e-21 TIGR00686: putative alkylphosphonate utilization operon protein PhnA" amino acids 2 to 111 (110 residues), 200.5 bits, see alignment E=2.5e-64 PF03831: YjdM" amino acids 44 to 111 (68 residues), 117.4 bits, see alignment E=2e-38

Best Hits

Swiss-Prot: 88% identical to YJDM_ECOL6: Protein YjdM (yjdM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_08740)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWJ5 at UniProt or InterPro

Protein Sequence (111 amino acids)

>BWI76_RS02240 alkylphosphonate utilization operon protein PhnA (Klebsiella michiganensis M5al)
MQLPHCPKCHSEYTYEDNGMFVCPECAHEWNNAEPVDDNDALIVKDANGNLLADGDSVTV
VKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN