Protein Info for BWI76_RS02170 in Klebsiella michiganensis M5al

Annotation: MurR/RpiR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF01418: HTH_6" amino acids 14 to 89 (76 residues), 85.3 bits, see alignment E=3.6e-28 PF01380: SIS" amino acids 137 to 265 (129 residues), 113.4 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 94% identical to RPIR_ECOL6: HTH-type transcriptional regulator RpiR (rpiR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 94% identity to eco:b4089)

Predicted SEED Role

"Transcriptional regulator of D-allose utilization, RpiR family" in subsystem D-allose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWJ3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BWI76_RS02170 MurR/RpiR family transcriptional regulator (Klebsiella michiganensis M5al)
MSQSESSSLPNGIGLAPWLRMKQEGMTENESRIVEWLLTPGNLSDAPAIKDVAEALSVSE
AMIVKVSKLLGFSGFRNLRSALEAYFSQSEQVLPTELSFDEAPQDVVNKVFNITLRTIME
GQSIVNVDEIHRAARFFAQANQRDLYGAGGSNAICADVQHKFLRIGVRCQAYPDAHIMMM
SASLLKEGDVVLVVSHSGRTSDIKSAVELAKKNGAKIICITHSYHSPIAKLADFIICSPA
PETPLLGRNASARILQLTLLDAFFVSVAQLNIEQANLNMQKTGAIVNFFSPGALK