Protein Info for BWI76_RS02120 in Klebsiella michiganensis M5al

Annotation: multidrug resistance transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 16 to 479 (464 residues), 267.7 bits, see alignment E=9.6e-84 PF02321: OEP" amino acids 68 to 269 (202 residues), 38.7 bits, see alignment E=4.9e-14 amino acids 297 to 449 (153 residues), 50.7 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 83% identical to MDTP_SHIFL: Multidrug resistance outer membrane protein MdtP (mdtP) from Shigella flexneri

KEGG orthology group: None (inferred from 83% identity to ecm:EcSMS35_4544)

MetaCyc: 82% identical to putative multidrug efflux pump outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-351

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWI8 at UniProt or InterPro

Protein Sequence (487 amino acids)

>BWI76_RS02120 multidrug resistance transporter (Klebsiella michiganensis M5al)
MTRNLSRLLLCGLLGSATALSGCALVRKDFTPHQQLQPEQIKLASDIHLASQGWPQAQWW
RQFNDPQLDALIQRSLSGSHTLAEAKLREEKAQSQADLLEAGTQLQVAAMGMLNRQRVST
NGFLGPFADQSDSRLMPMDGPYYTEGTVGLLAGLDLDLWGVHRSAVAAAIGAQNAAVAET
ATVELAISTGVAQLYYSMQASYQMLDLLQQTREVIEYAVEAHQSKVAHGLEAQVPYHGAR
AQVLAVDKQIAAVKGQIVETRETLRALIGAGAGDLPAIKPVSLPRVQTGIPATLSYDLLA
RRPDLQAMRWYVQASLNQVNAARALFYPSFDIKAFFGVDSIHLDKLFENRSKQINFIPGL
TLPLFDGGRLNANLESTRASSNMLIERYNQSVLDAVRDVAINGTRLQTLNDERTMQAERV
SAFRYTQAAAEAAYKRGLSSRLLATEARLPVLAEEMSLLILDSRRVVQSIQLIKTLGGGY
QAPVAKK