Protein Info for BWI76_RS02105 in Klebsiella michiganensis M5al

Annotation: glutamate/aspartate:proton symporter GltP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 7 to 9 (3 residues), see Phobius details transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 48 to 73 (26 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 236 to 264 (29 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 357 to 383 (27 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details PF00375: SDF" amino acids 9 to 412 (404 residues), 402.1 bits, see alignment E=1.4e-124

Best Hits

Swiss-Prot: 92% identical to GLTP_ECOLI: Proton/glutamate-aspartate symporter (gltP) from Escherichia coli (strain K12)

KEGG orthology group: K11102, proton glutamate symport protein (inferred from 98% identity to kpe:KPK_5189)

MetaCyc: 92% identical to glutamate/aspartate : H+ symporter GltP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122A; TRANS-RXN-162

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWD3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BWI76_RS02105 glutamate/aspartate:proton symporter GltP (Klebsiella michiganensis M5al)
MKKKTKVSMAWQILLALVLGILLGSYLHYHAESRDWLISNLLTPAGDIFIHLIKMIVVPI
VISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIVLGITLANVFQPGSGIDMSQLAA
VDISKYQNTTAEVQSHAHGLMGTILSLVPTNIVASMAKGDMLPIIFFSVLFGLGLSSLPA
THREPLVTVFRSISETMFKVTHMVMRYAPVGVFALISVTVATFGFASLWPLAKLVILVYF
AILFFALVVLGIVARVCGLSIWTLIRILKDELILAYSTASSESVLPRIIEKMEAYGAPAS
ITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEITLVLTLMVTSKGIAGVPG
VSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKK
ALAYEREVLGKFDKTAQ