Protein Info for BWI76_RS02055 in Klebsiella michiganensis M5al

Annotation: murein hydrolase effector protein LrgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details PF04172: LrgB" amino acids 14 to 224 (211 residues), 231.6 bits, see alignment E=3.6e-73

Best Hits

Swiss-Prot: 32% identical to YWBG_BACSU: Uncharacterized protein YwbG (ywbG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_08590)

Predicted SEED Role

"CidA-associated membrane protein CidB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWC4 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BWI76_RS02055 murein hydrolase effector protein LrgB (Klebsiella michiganensis M5al)
MSDFQLSVLCLLVTLGLYFSNKRLYRRFHKLPLMPLVFTPILLVILLIFGHISYQCYMGE
AHWLLWLLGPATIAFAVPVYDNLAIIKRHWMSLTAGVTTASVVAVTSSVWLARLFTLPDE
IQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVVTGVFGMAVGDVLFLRLSIREGMAKG
AGFGAASHGAGTARSYELGPQEGVIASLVMMLSGVVMVLAAPMVRWALF