Protein Info for BWI76_RS02035 in Klebsiella michiganensis M5al

Annotation: acetolactate synthase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF02776: TPP_enzyme_N" amino acids 7 to 136 (130 residues), 93.8 bits, see alignment E=1e-30 PF00205: TPP_enzyme_M" amino acids 213 to 313 (101 residues), 46.4 bits, see alignment E=5.1e-16 PF02775: TPP_enzyme_C" amino acids 414 to 565 (152 residues), 75.1 bits, see alignment E=8.2e-25

Best Hits

KEGG orthology group: None (inferred from 72% identity to eae:EAE_01745)

Predicted SEED Role

"Thiamine pyrophosphate-requiring protein Saci_2281"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWC3 at UniProt or InterPro

Protein Sequence (569 amino acids)

>BWI76_RS02035 acetolactate synthase catalytic subunit (Klebsiella michiganensis M5al)
MQLINISAAEMILYRLQALGVEFIFINSGTDYPPMVEAYSRLKSEGCLVPEFVVCPHENA
AIGMAHGYYLATGKVQAVMVHTNVGLANAACGIINLANSNIPVIIFGGRTPISEHSHFGC
RNTPIGYGQEMRDQAALVRESVKWDFELRYADQAGEHVDRAWAIANSLPKGPVYLSLPRE
PLCETFATDSAALNCRPSQQPISFSPAPDSLSMAATLIANARHPVIFSQRGARTRQAFDL
ISTFVEQWAIPVVEYWGTEVTISAAHPMYAGNEPAYWLSKADVVIVIDSQAPWMIESMNV
NPDCKVIQIGPDPLFSRYPVRGYQSDVNLAGETDTIFKLLDNALKPYLAEKSASVEERYS
HVAAHNKKERTTRDNLVDSANAGPIGKPWLSYCLGALANKYNGKITSELTTLPQFANFIQ
PESYYQEALSGGLGEAFPIALGLQLANRDELVIAAVGDGSYLFSNPAVCHHIAEVMKLPV
LVVVGNNAGWGAVAGGTLALYPDGYAAKMDKVPATSFTLSPDLAAIAASSRAVAMKVDRA
EDLLDTLEEAVNIIRTQKRSVLVDVILGK