Protein Info for BWI76_RS02030 in Klebsiella michiganensis M5al

Annotation: auxin efflux carrier

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 229 to 229 (1 residues), see Phobius details amino acids 231 to 257 (27 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details PF03547: Mem_trans" amino acids 9 to 306 (298 residues), 120.7 bits, see alignment E=2.8e-39

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_01740)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWB1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BWI76_RS02030 auxin efflux carrier (Klebsiella michiganensis M5al)
MTNNSILLILGAILPVIVTVLLGYISGKRKDFAWEQAGAINKLVMLYALPLSIFSNMVMT
PRSIVMNMGPVAAAIIVALIVSFLIPLLVARYICRRDLSLSTLQALAIGSPAVPFIGTSV
LAFLFGTVSASLITVSSITQNVFQLPLVMILMSYASGDKNNTSFISSVINAIKQPVVWSP
VLALIIVIMDIHIPETVAMSLGLLGKATGGLALFSAGIVLYARSVVITLPTIITVIARNI
IVPGLCYFALVGLGFSMEQIKEVVLTMAIPVGSIAIIIAMQYKTGEQEMASTMALSIIAS
ILTMGGFILLTF