Protein Info for BWI76_RS02000 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 12 to 151 (140 residues), 240.7 bits, see alignment E=1.9e-76 PF13411: MerR_1" amino acids 13 to 75 (63 residues), 48.1 bits, see alignment E=1.6e-16 PF00376: MerR" amino acids 13 to 49 (37 residues), 54.1 bits, see alignment E=1.7e-18 PF09278: MerR-DNA-bind" amino acids 54 to 119 (66 residues), 57.7 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 90% identical to SOXR_SALTI: Redox-sensitive transcriptional activator SoxR (soxR) from Salmonella typhi

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 99% identity to kva:Kvar_4783)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWB3 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BWI76_RS02000 transcriptional regulator (Klebsiella michiganensis M5al)
MEKKSPRIKMLLTPGEVAKRTGVAVSALHFYESKGLIHSQRNAGNQRRYRRDVLRAVAII
KIAQRIGIPLATIGDAFGVLPEGHNLSAKEWKMLSSQWREELDRRIHTLTALRDQLDGCI
GCGCLSRRDCPLRNPGDKLGEEGTGARLLEDD