Protein Info for BWI76_RS01990 in Klebsiella michiganensis M5al

Annotation: cyclic diguanylate phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details signal peptide" amino acids 31 to 31 (1 residues), see Phobius details PF12792: CSS-motif" amino acids 40 to 242 (203 residues), 147.8 bits, see alignment E=3e-47 PF00563: EAL" amino acids 273 to 505 (233 residues), 233 bits, see alignment E=3.2e-73

Best Hits

Swiss-Prot: 57% identical to PDEC_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeC (pdeC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 74% identity to eae:EAE_08550)

MetaCyc: 57% identical to cyclic di-GMP phosphodiesterase PdeC (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FIG00732651: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWE6 at UniProt or InterPro

Protein Sequence (534 amino acids)

>BWI76_RS01990 cyclic diguanylate phosphodiesterase (Klebsiella michiganensis M5al)
MNHSAPRKALRIFGIVLVILLPVLLALWFAQIRAKAETGDQLRLFSRLALQKTELVIREA
DEARDKARLYQGEICSPQHQQYLLGIVRGLLYIDDLIYANGTHFFCSTTVRRPTGWRIPA
ATYTKKPDIAIYYYRETPFYPDYAMNYMQRGNYVVVVNPLSYSALITSDRNLAWGVFDTK
TRQFFSVSKNADPAELHRLIRAEEALFHQDGRVYTIAHSSVRPIAVIMSTSRVSYYQNFY
NQVTLTLPLGLICSVLLLLVWSRTRQQYHSPRKMLQRALSRRQLCLHYQPVIDIKNHRCV
GTEALLRWPGFDGPVMSPAEFIPLAENEGMIAQVTDYVIEEVFADLGEFLARQPHLYVAI
NLSASDFHSARLIENINEKIRRYAVKAEQIKIEVTERGFIDVAKTTPVIQAFREAGYEIA
IDDFGTGYSNLNNLHALNVDVLKIDKSFVDMLTSNTTSHMIAEHIIQMANSLRLKIVAEG
VETAEQVAWLQKRGVQYCQGWHFAKAMPPQEFMQWLANDRISLCPYQQPYQAEI