Protein Info for BWI76_RS01920 in Klebsiella michiganensis M5al

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR00492: alanine racemase" amino acids 3 to 359 (357 residues), 477.4 bits, see alignment E=1.4e-147 PF01168: Ala_racemase_N" amino acids 8 to 219 (212 residues), 238.1 bits, see alignment E=9.6e-75 PF00842: Ala_racemase_C" amino acids 234 to 357 (124 residues), 135.2 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 91% identical to ALR1_ECOL6: Alanine racemase, biosynthetic (alr) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 93% identity to kva:Kvar_4808)

MetaCyc: 90% identical to alanine racemase 1 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase, biosynthetic (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWD7 at UniProt or InterPro

Protein Sequence (359 amino acids)

>BWI76_RS01920 alanine racemase (Klebsiella michiganensis M5al)
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGIAQPILLLEGFFEAADLPVISTQRLHTAVHSPEQLAALEEADLPEPVTVW
MKLDTGMHRLGVLPEQAEAFYQRLSQCKNVRQPVNVVSHFARADEPECGATERQLDIFTT
FTEGKPGLRSIAASGGILLWPQSHFDWARPGIILYGVSPLDGGSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPEAQDKSGDPVVLWGEGLPVERIAAITKVSAYELITRLTSRVSMKYVD