Protein Info for BWI76_RS01880 in Klebsiella michiganensis M5al

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details PF01554: MatE" amino acids 16 to 176 (161 residues), 115.8 bits, see alignment E=1.6e-37 amino acids 240 to 393 (154 residues), 38.7 bits, see alignment E=8.3e-14 TIGR00797: MATE efflux family protein" amino acids 16 to 409 (394 residues), 325.3 bits, see alignment E=2.6e-101 PF14667: Polysacc_synt_C" amino acids 137 to 226 (90 residues), 29.3 bits, see alignment E=8.9e-11

Best Hits

Swiss-Prot: 85% identical to DINF_ECOLI: DNA damage-inducible protein F (dinF) from Escherichia coli (strain K12)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 91% identity to kpu:KP1_0284)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWD8 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BWI76_RS01880 MATE family efflux transporter (Klebsiella michiganensis M5al)
MLFNAADKALWRLALPMIFSNITVPLLGLVDTAVIGHLDSPIYLGGVAVGATATSFLFML
LLFLRMSTTGLTAQAFGARDPQRLARALVQPLGLALAAGLAIVLFRIPLINLALHIVGGS
EAVLEQARRFLEIRWLSAPASLANLVLLGWLLGVQYARAPVILLVVGNVLNIVLDLWLVM
GLHMNVQGAALATVMAEYATFFIGLLMARRVLALRGVSLSMLKNAWRGDIRRLLALNRDI
MLRSLLLQLCFGAVTVFGARLGADIVAVNAVLMTMLTFTAYALDGFAYAVEAHSGQAYGA
RDDSQLLAVWHAACRQSGLVALAFALIYGLAGEQIIALLTSLPSLQQLADRYLVWQMILP
VIGVWCYLLDGMFIGATRGAEMRNSMAVAAAGFALTLLTVPALGNHGLWLALAVFLALRG
ASLAVIWRRHWQRGTWFS