Protein Info for BWI76_RS01875 in Klebsiella michiganensis M5al

Annotation: repressor LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00498: repressor LexA" amino acids 1 to 199 (199 residues), 282.5 bits, see alignment E=8.7e-89 PF01726: LexA_DNA_bind" amino acids 1 to 65 (65 residues), 107 bits, see alignment E=3.3e-35 PF00717: Peptidase_S24" amino acids 77 to 192 (116 residues), 121 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 98% identical to LEXA_KLEP7: LexA repressor (lexA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 97% identity to kpe:KPK_5245)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWC2 at UniProt or InterPro

Protein Sequence (202 amino acids)

>BWI76_RS01875 repressor LexA (Klebsiella michiganensis M5al)
MKALTTRQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGAIEIVS
GASRGIRLLTEEETGLPLIGRVAAGEPLLAQQHIEGHYQVDPAMFKPNADFLLRVSGMSM
KDIGILDGDLLAVHKTQDVRNGQVVVARIDEEVTVKRLKKQGNVVELLPENSEFSPIVVD
LREQSFTIEGLAVGVIRNGNWQ