Protein Info for BWI76_RS01745 in Klebsiella michiganensis M5al

Updated annotation (from data): Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)
Rationale: Specifically important for utilizing L-Sorbose. Automated validation from mutant phenotype: the predicted function (1.1.1.140) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: sorbitol-6-phosphate 2-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 202 (193 residues), 185.2 bits, E=1.9e-58
• PF08659: KR
  • amino acids 13 to 177 (165 residues), 37.2 bits, E=6e-13
• PF13561: adh_short_C2
  • amino acids 18 to 264 (247 residues), 158.4 bits, E=4.6e-50

Best Hits

Swiss-Prot: 88% identical to SORD_KLEPN: Sorbitol-6-phosphate 2-dehydrogenase (sorD) from Klebsiella pneumoniae

KEGG orthology group: K00068, sorbitol-6-phosphate 2-dehydrogenase [EC: 1.1.1.140] (inferred from 88% identity to kpn:KPN_04407)

MetaCyc: 58% identical to sorbitol-6-phosphate dehydrogenase subunit (Streptococcus mutans)
Sorbitol-6-phosphate 2-dehydrogenase. [EC: 1.1.1.140]

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• L-sorbose degradation (2/2 steps found)
• D-sorbitol degradation II (1/1 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See A0A285AW98 at UniProt or InterPro

Protein Sequence (267 amino acids)

>BWI76_RS01745 Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (Klebsiella michiganensis M5al)
MNTWLNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDI
SSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQ
KGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGK
HGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVAD
FVCYLLSERASYMTGVTTNIAGGKTRG